PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_AchrUn_randomP15140_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family NF-YA
Protein Properties Length: 312aa    MW: 33704 Da    PI: 8.6739
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_AchrUn_randomP15140_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.25.5e-33137193158
                      CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                    +eplYVNaKQy++Il+RRq Rakle+++kl +k+rkpylheSRh hA++R+RgsgGrF
  GSMUA_AchrUn_randomP15140_001 137 EEPLYVNAKQYNAILRRRQLRAKLEAQNKL-IKARKPYLHESRHLHAMKRARGSGGRF 193
                                    69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-38135196IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.543136196IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.7E-28138193IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-23139161IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860141161IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.1E-23170193IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGFLAKDGNQ VKQLSHPISD HDSSTQSTGQ SCQEASGTSE DNVHEQHISV NSGVGNTYKN  60
LVDGHMKPIL SLGTSETAFS FPKLDYSQSF AHVPYPCADP YFGGILALCG PHAMIHPQMV  120
GIASSGRVPL PLQPAAEEPL YVNAKQYNAI LRRRQLRAKL EAQNKLIKAR KPYLHESRHL  180
HAMKRARGSG GRFLNTKQLQ QQKQTQTSAI SGCQDHSGSK LCSGSGSIGS SAPSINSNIR  240
TASTNGSMLT QQDHLSFPFP DFHSNVGVGT QGGHTMMGGV VQSFNCSNKC MDPTLVVTLW  300
SVDNLLEILF LS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-23137198263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009387069.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_009387070.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_009387071.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_009387072.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_009387073.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_009387074.10.0PREDICTED: nuclear transcription factor Y subunit A-7-like
SwissprotQ93ZH22e-44NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLM0U9C30.0M0U9C3_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP15140_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.13e-35nuclear factor Y, subunit A3